OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRX (NM_020956) Human Mass Spec Standard

Be the first to review this product
SKU
PH316161
PRX MS Standard C13 and N15-labeled recombinant protein (NP_066007)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA380431 PRX Rabbit polyclonal Antibody
100 ul
$410.00
LY412179 Transient overexpression lysate of periaxin (PRX), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PRX or NM_020956"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216161
Predicted MW 15.8 kDa
Protein Sequence
Protein Sequence
>RC216161 protein sequence
Red=Cloning site Green=Tags(s)

MEARSRSAEELRRAELVEIIVETEAQTGVSGINVAGGGKEGIFVRELREDSPAARSLSLQEGDQLLSARV
FFENFKYEDALRLLQCAEPYKVSFCLKRTVPTGDLALRPGTVSGYEIKGPRAKVAKLVRVLSPAPALDCP
SDPVSAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066007
RefSeq Size 5502
RefSeq ORF 441
Synonyms CMT4F
Locus ID 57716
UniProt ID Q9BXM0
Cytogenetics 19q13.2
Summary This gene encodes a protein involved in peripheral nerve myelin upkeep. The encoded protein contains 2 PDZ domains which were named after PSD95 (post synaptic density protein), DlgA (Drosophila disc large tumor suppressor), and ZO1 (a mammalian tight junction protein). Two alternatively spliced transcript variants have been described for this gene which encode different protein isoforms and which are targeted differently in the Schwann cell. Mutations in this gene cause Charcot-Marie-Tooth neuoropathy, type 4F and Dejerine-Sottas neuropathy. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PRX" proteins (3)
SKU Description Size Price
LC412179 Lyophilized PRX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412179 Transient overexpression lysate of periaxin (PRX), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP316161 Recombinant protein of human periaxin (PRX), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products