FTHL17 (NM_031894) Human Mass Spec Standard
CAT#: PH314888
FTHL17 MS Standard C13 and N15-labeled recombinant protein (NP_114100)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214888 |
Predicted MW | 21.1 kDa |
Protein Sequence |
>RC214888 protein sequence
Red=Cloning site Green=Tags(s) MATAQPSQVRQKYDTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKL MRLQNLRGGHICLHDIRKPECQGWESGLVAMESAFHLEKNVNQSLLDLYQLAVEKGDPQLCHFLESHYLH EQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKET myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_114100 |
RefSeq Size | 830 |
RefSeq ORF | 549 |
Synonyms | CT38 |
Locus ID | 53940 |
UniProt ID | Q9BXU8, A0A384NPV7 |
Cytogenetics | Xp21.2 |
Summary | This gene encodes a ferritin heavy chain-like protein. This gene is primarily expressed in embryonic germ cells. The encoded protein may lack ferroxidase activity. Multiple pseudogenes of this gene are found on chromosome X. [provided by RefSeq, Oct 2016] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410455 | FTHL17 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY410455 | Transient overexpression lysate of ferritin, heavy polypeptide-like 17 (FTHL17) |
USD 436.00 |
|
TP314888 | Recombinant protein of human ferritin, heavy polypeptide-like 17 (FTHL17), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review