Calcitonin (CALCA) (NM_001741) Human Mass Spec Standard

CAT#: PH314594

CALCA MS Standard C13 and N15-labeled recombinant protein (NP_001732)

Product Images

Coomassie blue staining of purified CALCA protein (Cat# TP314594). The protein was produced from HEK293T cells transfected with CALCA cDNA clone (Cat# RC214594) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214594
• Predicted MW: 15.5 kDa
• Protein Sequence:
  Sequence Link

  >RC214594 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQ
  EREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNA
  N
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001732
• RefSeq Size: 792
• RefSeq ORF: 423
• Synonyms: CALC1; CGRP; CGRP-alpha; CGRP-I; CGRP1; CT; KC; PCT
• Locus ID: 796
• UniProt ID: P01258
• Cytogenetics: 11p15.2
• Summary: This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide and katacalcin by tissue-specific alternative RNA splicing of the gene transcripts and cleavage of inactive precursor proteins. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2014]
• Protein Families: Druggable Genome, Secreted Protein