RS1 (NM_000330) Human Mass Spec Standard

CAT#: PH314267

RS1 MS Standard C13 and N15-labeled recombinant protein (NP_000321)

Product Images

Coomassie blue staining of purified RS1 protein (Cat# TP314267). The protein was produced from HEK293T cells transfected with RS1 cDNA clone (Cat# RC214267) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214267
• Predicted MW: 25.59 kDa
• Protein Sequence:
  Sequence Link

  >RC214267 representing NM_000330
  Red=Cloning site Green=Tags(s)
  
  MSRKIEGFLLLLLFGYEATLGLSSTEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLG
  FESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQG
  RCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRI
  AIRMELLECVSKCA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000321
• RefSeq Size: 3046
• RefSeq ORF: 672
• Synonyms: RS; XLRS1
• Locus ID: 6247
• UniProt ID: O15537
• Cytogenetics: Xp22.13
• Summary: This gene encodes an extracellular protein that plays a crucial role in the cellular organization of the retina. The encoded protein is assembled and secreted from photoreceptors and bipolar cells as a homo-oligomeric protein complex. Mutations in this gene are responsible for X-linked retinoschisis, a common, early-onset macular degeneration in males that results in a splitting of the inner layers of the retina and severe loss in vision. [provided by RefSeq, Oct 2008]
• Protein Families: Secreted Protein