BEX4 (NM_001080425) Human Mass Spec Standard
CAT#: PH313659
BEX4 MS Standard C13 and N15-labeled recombinant protein (NP_001073894)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213659 |
Predicted MW | 13.9 kDa |
Protein Sequence |
>RC213659 representing NM_001080425
Red=Cloning site Green=Tags(s) MESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRH IEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001073894 |
RefSeq Size | 1245 |
RefSeq ORF | 360 |
Synonyms | BEXL1 |
Locus ID | 56271 |
UniProt ID | Q9NWD9 |
Cytogenetics | Xq22.1 |
Summary | This gene is a member of the brain expressed X-linked gene family. The proteins encoded by some of the other members of this family act as transcription elongation factors which allow RNA polymerase II to escape pausing during elongation. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421642 | BEX4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY421642 | Transient overexpression lysate of brain expressed, X-linked 4 (BEX4), transcript variant 2 |
USD 436.00 |
|
TP313659 | Recombinant protein of human brain expressed, X-linked 4 (BEX4), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review