METTL1 (NM_005371) Human Mass Spec Standard

CAT#: PH312768

METTL1 MS Standard C13 and N15-labeled recombinant protein (NP_005362)

Product Images

Coomassie blue staining of purified METTL1 protein (Cat# TP312768). The protein was produced from HEK293T cells transfected with METTL1 cDNA clone (Cat# RC212768) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212768
• Predicted MW: 31.3 kDa
• Protein Sequence:
  Sequence Link

  >RC212768 representing NM_005371
  Red=Cloning site Green=Tags(s)
  
  MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKK
  EKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSN
  AMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTH
  FEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005362
• RefSeq Size: 1743
• RefSeq ORF: 828
• Synonyms: C12orf1; TRM8; TRMT8; YDL201w
• Locus ID: 4234
• UniProt ID: Q9UBP6
• Cytogenetics: 12q14.1
• Summary: This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome