P15RS (RPRD1A) (NM_018170) Human Mass Spec Standard

CAT#: PH312551

RPRD1A MS Standard C13 and N15-labeled recombinant protein (NP_060640)

Product Images

Coomassie blue staining of purified RPRD1A protein (Cat# TP312551). The protein was produced from HEK293T cells transfected with RPRD1A cDNA clone (Cat# RC212551) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212551
• Predicted MW: 35.5 kDa
• Protein Sequence:
  Sequence Link

  >RC212551 representing NM_018170
  Red=Cloning site Green=Tags(s)
  
  MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFLYLANDVIQNS
  KRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTY
  EQIKVDENENCSSLGSPSEPPQTLDLVRALQDLENAASGDAAVHQRIASLPVEVQEVSLLDKITDKESGE
  RLSKMVEDACMLLADYNGRLAAEIDDRKQLTRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELR
  SRIQSLPDLSRLPNVTGSHMHLPFAGDIYSED
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060640
• RefSeq Size: 4284
• RefSeq ORF: 936
• Synonyms: HsT3101; P15RS
• Locus ID: 55197
• UniProt ID: Q96P16, A0A024RC37
• Cytogenetics: 18q12.2
• Summary: This gene encodes a cell-cycle and transcription regulatory protein. The encoded protein interacts with the cell cycle inhibitor cyclin-dependent kinase 4 inhibitor B and may function as a negative regulator of G(1)/S phase progression. This protein also forms homo- and hetrodimers with the protein, regulation of nuclear pre-mRNA domain-containing protein 1B, to form a scaffold that interacts with the C-terminal domain of RNA polymerase II subunit B1 and regulates several aspects of transcription. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 16. [provided by RefSeq, Dec 2014]