OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

P15RS (RPRD1A) (NM_018170) Human Mass Spec Standard

Be the first to review this product
SKU
PH312551
RPRD1A MS Standard C13 and N15-labeled recombinant protein (NP_060640)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358234 RPRD1A Antibody - N-terminal region
100 ul
$585.00
LY413267 Transient overexpression lysate of regulation of nuclear pre-mRNA domain containing 1A (RPRD1A) (as WB positive control) 100 ug
$436.00

Other products for "P15RS or NM_018170"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212551
Predicted MW 35.5 kDa
Protein Sequence
Protein Sequence
>RC212551 representing NM_018170
Red=Cloning site Green=Tags(s)

MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFLYLANDVIQNS
KRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTY
EQIKVDENENCSSLGSPSEPPQTLDLVRALQDLENAASGDAAVHQRIASLPVEVQEVSLLDKITDKESGE
RLSKMVEDACMLLADYNGRLAAEIDDRKQLTRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELR
SRIQSLPDLSRLPNVTGSHMHLPFAGDIYSED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060640
RefSeq Size 4284
RefSeq ORF 936
Synonyms HsT3101; P15RS
Locus ID 55197
UniProt ID Q96P16
Cytogenetics 18q12.2
Summary This gene encodes a cell-cycle and transcription regulatory protein. The encoded protein interacts with the cell cycle inhibitor cyclin-dependent kinase 4 inhibitor B and may function as a negative regulator of G(1)/S phase progression. This protein also forms homo- and hetrodimers with the protein, regulation of nuclear pre-mRNA domain-containing protein 1B, to form a scaffold that interacts with the C-terminal domain of RNA polymerase II subunit B1 and regulates several aspects of transcription. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 16. provided by RefSeq, Dec 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "P15RS" proteins (3)
SKU Description Size Price
LC413267 Lyophilized RPRD1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413267 Transient overexpression lysate of regulation of nuclear pre-mRNA domain containing 1A (RPRD1A) (as WB positive control) 100 ug
$436.00
TP312551 Recombinant protein of human regulation of nuclear pre-mRNA domain containing 1A (RPRD1A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products