SMUG1 (NM_014311) Human Mass Spec Standard
CAT#: PH312141
SMUG1 MS Standard C13 and N15-labeled recombinant protein (NP_055126)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212141 |
Predicted MW | 29.7 kDa |
Protein Sequence |
>RC212141 representing NM_014311
Red=Cloning site Green=Tags(s) MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVT RYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEVSGAR FWGFFRNLCGQPEVFFHHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLGICDAALCRQVQLLGVRLV VGVGRLAEQRARRALAGLMPEVQVEGLLHPSPRNPQANKGWEAVAKERLNELGLLPLLLK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055126 |
RefSeq Size | 1570 |
RefSeq ORF | 810 |
Synonyms | FDG; HMUDG; UNG3 |
Locus ID | 23583 |
UniProt ID | Q53HV7, A0A024RAZ8 |
Cytogenetics | 12q13.13 |
Summary | This gene encodes a protein that participates in base excision repair by removing uracil from single- and double-stranded DNA. Many alternatively spliced transcript variants exist for this gene; the full-length nature is known for some but not all of the variants. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Base excision repair |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415367 | SMUG1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415367 | Transient overexpression lysate of single-strand-selective monofunctional uracil-DNA glycosylase 1 (SMUG1) |
USD 436.00 |
|
TP312141 | Recombinant protein of human single-strand-selective monofunctional uracil-DNA glycosylase 1 (SMUG1), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review