SMUG1 (NM_014311) Human Mass Spec Standard

CAT#: PH312141

SMUG1 MS Standard C13 and N15-labeled recombinant protein (NP_055126)

Product Images

Coomassie blue staining of purified SMUG1 protein (Cat# TP312141). The protein was produced from HEK293T cells transfected with SMUG1 cDNA clone (Cat# RC212141) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212141
• Predicted MW: 29.7 kDa
• Protein Sequence:
  Sequence Link

  >RC212141 representing NM_014311
  Red=Cloning site Green=Tags(s)
  
  MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVT
  RYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEVSGAR
  FWGFFRNLCGQPEVFFHHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLGICDAALCRQVQLLGVRLV
  VGVGRLAEQRARRALAGLMPEVQVEGLLHPSPRNPQANKGWEAVAKERLNELGLLPLLLK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055126
• RefSeq Size: 1570
• RefSeq ORF: 810
• Synonyms: FDG; HMUDG; UNG3
• Locus ID: 23583
• UniProt ID: Q53HV7, A0A024RAZ8
• Cytogenetics: 12q13.13
• Summary: This gene encodes a protein that participates in base excision repair by removing uracil from single- and double-stranded DNA. Many alternatively spliced transcript variants exist for this gene; the full-length nature is known for some but not all of the variants. [provided by RefSeq, Aug 2011]
• Protein Families: Druggable Genome
• Protein Pathways: Base excision repair