CLEC10A (NM_006344) Human Mass Spec Standard
CAT#: PH311598
CLEC10A MS Standard C13 and N15-labeled recombinant protein (NP_006335)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211598 |
Predicted MW | 32.7 kDa |
Protein Sequence |
>RC211598 representing NM_006344
Red=Cloning site Green=Tags(s) MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLV TLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAVHSEMLLRVQQLVQDLKKLTCQV ATLNNNGEEASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGS AYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVC EAGLGQTSQESH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006335 |
RefSeq Size | 1716 |
RefSeq ORF | 876 |
Synonyms | CD301; CLECSF13; CLECSF14; HML; HML2; MGL |
Locus ID | 10462 |
UniProt ID | Q8IUN9 |
Cytogenetics | 17p13.1 |
Summary | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405320 | CLEC10A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC416712 | CLEC10A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405320 | Transient overexpression lysate of C-type lectin domain family 10, member A (CLEC10A), transcript variant 1 |
USD 436.00 |
|
LY416712 | Transient overexpression lysate of C-type lectin domain family 10, member A (CLEC10A), transcript variant 2 |
USD 436.00 |
|
TP311598 | Recombinant protein of human C-type lectin domain family 10, member A (CLEC10A), transcript variant 2, 20 µg |
USD 867.00 |
|
TP720473 | Recombinant protein of human C-type lectin domain family 10, member A (CLEC10A), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review