NIT1 (NM_005600) Human Mass Spec Standard
CAT#: PH311519
NIT1 MS Standard C13 and N15-labeled recombinant protein (NP_005591)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211519 |
Predicted MW | 35.7 kDa |
Protein Sequence |
>RC211519 representing NM_005600
Red=Cloning site Green=Tags(s) MLGFITRPPHRFLSLLCPGLRIPQLSVLCAQPRPRAMAISSSSCELPLVAVCQVTSTPDKQQNFKTCAEL VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLARECGLWLSLGGFHERGQDWEQTQ KIYNCHVLLNSKGAVVATYRKTHLCDVEIPGQGPMCESNSTMPGPSLESPVSTPAGKIGLAVCYDMRFPE LSLALAQAGAEILTYPSAFGSITGPAHWEVLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDPWGT VVARCSEGPGLCLARIDLNYLRQLRRHLPVFQHRRPDLYGNLGHPLS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005591 |
RefSeq Size | 1385 |
RefSeq ORF | 981 |
Locus ID | 4817 |
UniProt ID | Q86X76 |
Cytogenetics | 1q23.3 |
Summary | This gene encodes a member of the nitrilase protein family with homology to bacterial and plant nitrilases, enzymes that cleave nitriles and organic amides to the corresponding carboxylic acids plus ammonia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401717 | NIT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC433784 | NIT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC434153 | NIT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401717 | Transient overexpression lysate of nitrilase 1 (NIT1) |
USD 436.00 |
|
LY433784 | Transient overexpression lysate of nitrilase 1 (NIT1), transcript variant 2 |
USD 436.00 |
|
LY434153 | Transient overexpression lysate of nitrilase 1 (NIT1), transcript variant 3 |
USD 436.00 |
|
TP311519 | Recombinant protein of human nitrilase 1 (NIT1), 20 µg |
USD 867.00 |
|
TP331154 | Purified recombinant protein of Homo sapiens nitrilase 1 (NIT1), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review