CAMK2N2 (NM_033259) Human Mass Spec Standard

CAT#: PH311256

CAMK2N2 MS Standard C13 and N15-labeled recombinant protein (NP_150284)

Product Images

Coomassie blue staining of purified CAMK2N2 protein (Cat# TP311256). The protein was produced from HEK293T cells transfected with CAMK2N2 cDNA clone (Cat# RC211256) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211256
• Predicted MW: 8.7 kDa
• Protein Sequence:
  Sequence Link

  >RC211256 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKG
  MGEKPPSGV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_150284
• RefSeq Size: 1360
• RefSeq ORF: 237
• Synonyms: CAM-KIIN; CAMKIIN
• Locus ID: 94032
• UniProt ID: Q96S95
• Cytogenetics: 3q27.1
• Summary: This gene encodes a protein that is highly similar to the rat CaM-KII inhibitory protein, an inhibitor of calcium/calmodulin-dependent protein kinase II (CAMKII). CAMKII regulates numerous physiological functions, including neuronal synaptic plasticity through the phosphorylation of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid-type glutamate (AMPA) receptors. Studies of the similar protein in rat suggest that this protein may function as a negative regulator of CaM-KII and may act to inhibit the phosphorylation of AMPA receptors. [provided by RefSeq, Jul 2008]