C1orf77 (CHTOP) (NM_015607) Human Mass Spec Standard

CAT#: PH311107

C1orf77 MS Standard C13 and N15-labeled recombinant protein (NP_056422)

Product Images

Coomassie blue staining of purified CHTOP protein (Cat# TP311107). The protein was produced from HEK293T cells transfected with CHTOP cDNA clone (Cat# RC211107) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211107
• Predicted MW: 26.5 kDa
• Protein Sequence:
  Sequence Link

  >RC211107 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPTPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALK
  LKQKSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLL
  RGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARP
  VLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056422
• RefSeq Size: 2172
• RefSeq ORF: 747
• Synonyms: C1orf77; C10orf77; FL-SRAG; FOP; pp7704; SRAG; SRAG-3; SRAG-5
• Locus ID: 26097
• UniProt ID: Q9Y3Y2
• Cytogenetics: 1q21.3
• Summary: This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Nov 2015]