SDR O (SDR9C7) (NM_148897) Human Mass Spec Standard

CAT#: PH310941

SDR9C7 MS Standard C13 and N15-labeled recombinant protein (NP_683695)

Product Images

Coomassie blue staining of purified SDR9C7 protein (Cat# TP310941). The protein was produced from HEK293T cells transfected with SDR9C7 cDNA clone (Cat# RC210941) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210941
• Predicted MW: 35.3 kDa
• Protein Sequence:
  Sequence Link

  >RC210941 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAALTDLSFMYRWFKNCNLVGNLSEKYVFITGCDSGFGNLLAKQLVDRGMQVLAACFTEEGSQKLQRDTS
  YRLQTTLLDVTKSESIKAAAQWVRDKVGEQGLWALVNNAGVGLPSGPNEWLTKDDFVKVINVNLVGLIEV
  TLHMLPMVKRARGRVVNMSSSGGRVAVIGGGYCVSKFGVEAFSDSIRRELYYFGVKVCIIEPGNYRTAIL
  GKENLESRMRKLWERLPQETRDSYGEDYFRIYTDKLKNIMQVAEPRVRDVINSMEHAIVSRSPRIRYNPG
  LDAKLLYIPLAKLPTPVTDFILSRYLPRPADSV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_683695
• RefSeq Size: 1765
• RefSeq ORF: 939
• Synonyms: ARCI13; RDHS; SDR-O; SDRO
• Locus ID: 121214
• UniProt ID: Q8NEX9
• Cytogenetics: 12q13.3
• Summary: This gene encodes a protein with similarity to the short-chain dehydrogenase/reductase (SDR) family but has not been shown to have retinoid or dehydrogenase activities. [provided by RefSeq, Apr 2010]
• Protein Families: Druggable Genome