RCSD 1 (RCSD1) (NM_052862) Human Mass Spec Standard

CAT#: PH310933

RCSD1 MS Standard C13 and N15-labeled recombinant protein (NP_443094)

Product Images

Coomassie blue staining of purified RCSD1 protein (Cat# TP310933). The protein was produced from HEK293T cells transfected with RCSD1 cDNA clone (Cat# RC210933) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210933
• Predicted MW: 44.5 kDa
• Protein Sequence:
  Sequence Link

  >RC210933 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEERPAETNANVDNSASPSVAQLAGRFREQAAAAKETPASKPTRRKPPCSLPLFPPKVDLGQNGEEKSPP
  NASHPPKFKVKSSPLIEKLQANLTFDPAALLPGASPKSPGLKAMVSPFHSPPSTPSSPGVRSRPSEAEEV
  PVSFDQPPEGSHLPCYNKVRTRGSIKRRPPSRRFRRSQSDCGELGDFRAVESSQQNGAKEEDGDEVLPSK
  SKAPGSPLSSEGAAGEGVRTLGPAEKPPLRRSPSRTEKQEEDRATEEAKNGEKARRSSEEVDGQHPAQEE
  VPESPQTSGPEAENRCGSPREEKPAGEEAEMEKATEVKGERVQNEEVGPEHDSQETKKLEEGAAVKETPH
  SPPGGVKGGDVPKQEKGKEKQQEGAVLEPGCSPQTGPAQLETSSEVQSEPAVPKPEDDTPVQDTKM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_443094
• RefSeq Size: 3012
• RefSeq ORF: 1248
• Synonyms: CAPZIP; MK2S4
• Locus ID: 92241
• UniProt ID: Q6JBY9
• Cytogenetics: 1q24.2
• Summary: Stress-induced phosphorylation of CAPZIP may regulate the ability of F-actin-capping protein to remodel actin filament assembly.[UniProtKB/Swiss-Prot Function]