RCSD 1 (RCSD1) (NM_052862) Human Recombinant Protein

CAT#: TP310933

Recombinant protein of human RCSD domain containing 1 (RCSD1), 20 µg

Product Images

Coomassie blue staining of purified RCSD1 protein (Cat# TP310933). The protein was produced from HEK293T cells transfected with RCSD1 cDNA clone (Cat# RC210933) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210933 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEERPAETNANVDNSASPSVAQLAGRFREQAAAAKETPASKPTRRKPPCSLPLFPPKVDLGQNGEEKSPP
  NASHPPKFKVKSSPLIEKLQANLTFDPAALLPGASPKSPGLKAMVSPFHSPPSTPSSPGVRSRPSEAEEV
  PVSFDQPPEGSHLPCYNKVRTRGSIKRRPPSRRFRRSQSDCGELGDFRAVESSQQNGAKEEDGDEVLPSK
  SKAPGSPLSSEGAAGEGVRTLGPAEKPPLRRSPSRTEKQEEDRATEEAKNGEKARRSSEEVDGQHPAQEE
  VPESPQTSGPEAENRCGSPREEKPAGEEAEMEKATEVKGERVQNEEVGPEHDSQETKKLEEGAAVKETPH
  SPPGGVKGGDVPKQEKGKEKQQEGAVLEPGCSPQTGPAQLETSSEVQSEPAVPKPEDDTPVQDTKM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 44.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_443094
• Locus ID: 92241
• UniProt ID: Q6JBY9
• Cytogenetics: 1q24.2
• Refseq Size: 3012
• Refseq ORF: 1248
• Synonyms: CAPZIP; MK2S4
• Summary: Stress-induced phosphorylation of CAPZIP may regulate the ability of F-actin-capping protein to remodel actin filament assembly.[UniProtKB/Swiss-Prot Function]