Precerebellin (CBLN1) (NM_004352) Human Mass Spec Standard

CAT#: PH310797

CBLN1 MS Standard C13 and N15-labeled recombinant protein (NP_004343)

Product Images

Coomassie blue staining of purified CBLN1 protein (Cat# TP310797). The protein was produced from HEK293T cells transfected with CBLN1 cDNA clone (Cat# RC210797) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210797
• Predicted MW: 21.1 kDa
• Protein Sequence:
  Sequence Link

  >RC210797 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLGVLELLLLGAAWLAGPARGQNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSAIRST
  NHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVIS
  AFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004343
• RefSeq Size: 2435
• RefSeq ORF: 579
• Locus ID: 869
• UniProt ID: P23435
• Cytogenetics: 16q12.1
• Summary: This gene encodes a cerebellum-specific precursor protein, precerebellin, with similarity to the globular (non-collagen-like) domain of complement component C1qB. Precerebellin is processed to give rise to several derivatives, including the hexadecapeptide, cerebellin, which is highly enriched in postsynaptic structures of Purkinje cells. Cerebellin has also been found in human and rat adrenals, where it has been shown to enhance the secretory activity of this gland. [provided by RefSeq, Aug 2008]
• Protein Families: Secreted Protein