TOMM20 (NM_014765) Human Mass Spec Standard

CAT#: PH310746

TOMM20 MS Standard C13 and N15-labeled recombinant protein (NP_055580)

Product Images

Coomassie blue staining of purified TOMM20 protein (Cat# TP310746). The protein was produced from HEK293T cells transfected with TOMM20 cDNA clone (Cat# RC210746) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210746
• Predicted MW: 16.3 kDa
• Protein Sequence:
  Sequence Link

  >RC210746 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFF
  LEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLA
  EDDVE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055580
• RefSeq Size: 3407
• RefSeq ORF: 435
• Synonyms: MAS20; MOM19; TOM20
• Locus ID: 9804
• UniProt ID: Q15388, A0A024R3W2
• Cytogenetics: 1q42.3
• Summary: Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore (By similarity). Required for the translocation across the mitochondrial outer membrane of cytochrome P450 monooxygenases.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane