PDE6H (NM_006205) Human Mass Spec Standard
CAT#: PH310215
PDE6H MS Standard C13 and N15-labeled recombinant protein (NP_006196)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210215 |
Predicted MW | 9.1 kDa |
Protein Sequence |
>RC210215 protein sequence
Red=Cloning site Green=Tags(s) MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFS HLELHELAQFGII myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006196 |
RefSeq Size | 763 |
RefSeq ORF | 249 |
Synonyms | ACHM6; RCD3 |
Locus ID | 5149 |
UniProt ID | Q13956 |
Cytogenetics | 12p12.3 |
Summary | This gene encodes the inhibitory (or gamma) subunit of the cone-specific cGMP phosphodiesterase, which is a tetramer composed of two catalytic chains (alpha and beta), and two inhibitory chains (gamma). It is specifically expressed in the retina, and is involved in the transmission and amplification of the visual signal. Mutations in this gene are associated with retinal cone dystrophy type 3A (RCD3A). [provided by RefSeq, Mar 2010] |
Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416802 | PDE6H HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY416802 | Transient overexpression lysate of phosphodiesterase 6H, cGMP-specific, cone, gamma (PDE6H) |
USD 436.00 |
|
TP310215 | Recombinant protein of human phosphodiesterase 6H, cGMP-specific, cone, gamma (PDE6H), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review