FGF 23 (FGF23) (NM_020638) Human Mass Spec Standard

CAT#: PH310127

FGF23 MS Standard C13 and N15-labeled recombinant protein (NP_065689)

Product Images

Coomassie blue staining of purified FGF23 protein (Cat# TP310127). The protein was produced from HEK293T cells transfected with FGF23 cDNA clone (Cat# RC210127) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210127
• Predicted MW: 28 kDa
• Protein Sequence:
  Sequence Link

  >RC210127 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIY
  SALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGR
  AKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQEL
  PSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065689
• RefSeq Size: 3018
• RefSeq ORF: 753
• Synonyms: ADHR; FGFN; HFTC2; HPDR2; HYPF; PHPTC
• Locus ID: 8074
• UniProt ID: Q9GZV9
• Cytogenetics: 12p13.32
• Summary: This gene encodes a member of the fibroblast growth factor family of proteins, which possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. The product of this gene regulates phosphate homeostasis and transport in the kidney. The full-length, functional protein may be deactivated via cleavage into N-terminal and C-terminal chains. Mutation of this cleavage site causes autosomal dominant hypophosphatemic rickets (ADHR). Mutations in this gene are also associated with hyperphosphatemic familial tumoral calcinosis (HFTC). [provided by RefSeq, Feb 2013]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton