HESX1 (NM_003865) Human Mass Spec Standard

CAT#: PH310107

HESX1 MS Standard C13 and N15-labeled recombinant protein (NP_003856)

Product Images

Coomassie blue staining of purified HESX1 protein (Cat# TP310107). The protein was produced from HEK293T cells transfected with HESX1 cDNA clone (Cat# RC210107) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210107
• Predicted MW: 21.4 kDa
• Protein Sequence:
  Sequence Link

  >RC210107 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGIS
  FPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIRED
  LAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003856
• RefSeq Size: 1182
• RefSeq ORF: 555
• Synonyms: ANF; CPHD5; RPX
• Locus ID: 8820
• UniProt ID: Q9UBX0, A1LQR0
• Cytogenetics: 3p14.3
• Summary: This gene encodes a conserved homeobox protein that is a transcriptional repressor in the developing forebrain and pituitary gland. Mutations in this gene are associated with septooptic dysplasia, HESX1-related growth hormone deficiency, and combined pituitary hormone deficiency. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors