HESX1 (NM_003865) Human Tagged ORF Clone

CAT#: RC210107

HESX1 (Myc-DDK-tagged)-Human HESX homeobox 1 (HESX1)

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HESX1 (NM_003865) Human Tagged ORF Clone
Symbol HESX1
Synonyms ANF; CPHD5; RPX
Vector pCMV6-Entry
Sequence Data
>RC210107 representing NM_003865
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCCCAGCCTTCAGGAAGGCGCTCAGCTCGGGGAAAACAAACCCTCAACTTGCTCCTTTTCAATTG
AGAGAATCTTAGGACTGGACCAGAAGAAAGACTGTGTTCCATTAATGAAACCCCACAGGCCCTGGGCAGA
CACCTGCAGCTCATCAGGGAAAGATGGTAACTTATGTCTACATGTCCCAAATCCTCCCAGTGGGATTTCA
TTCCCTAGCGTGGTGGATCACCCAATGCCAGAAGAAAGAGCTTCGAAATATGAAAATTACTTTTCAGCCT
CAGAAAGACTGTCTTTGAAAAGAGAGTTGAGTTGGTATAGAGGCCGAAGACCAAGAACTGCTTTTACTCA
AAACCAGATTGAAGTGTTAGAAAATGTCTTTAGAGTAAACTGCTATCCTGGTATCGATATTAGAGAAGAC
TTAGCTCAAAAATTGAATCTAGAGGAAGACAGAATCCAGATTTGGTTTCAAAATCGGCGTGCAAAACTGA
AAAGGTCCCATAGAGAATCACAGTTTCTAATGGCGAAAAAAAATTTCAACACAAATCTGCTGGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210107 representing NM_003865
Red=Cloning site Green=Tags(s)

MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGIS
FPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIRED
LAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003865
ORF Size 555 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003865.1, NM_003865.2, NP_003856
RefSeq Size 892
RefSeq ORF 558
Locus ID 8820
Cytogenetics 3p14.3
Protein Families Transcription Factors, Druggable Genome
MW 21.2 kDa
Gene Summary This gene encodes a conserved homeobox protein that is a transcriptional repressor in the developing forebrain and pituitary gland. Mutations in this gene are associated with septooptic dysplasia, HESX1-related growth hormone deficiency, and combined pituitary hormone deficiency. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)