PTRHD1 (NM_001013663) Human Mass Spec Standard

CAT#: PH310056

C2orf79 MS Standard C13 and N15-labeled recombinant protein (NP_001013685)

Product Images

Coomassie blue staining of purified PTRHD1 protein (Cat# TP310056). The protein was produced from HEK293T cells transfected with PTRHD1 cDNA clone (Cat# RC210056) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210056
• Predicted MW: 15.6 kDa
• Protein Sequence:
  Sequence Link

  >RC210056 representing NM_001013663
  Red=Cloning site Green=Tags(s)
  
  MHRGVGPAFRVVRKMAASGAEPQVLVQYLVLRKDLSQAPFSWPAGALVAQACHAATAALHTHRDHPHTAA
  YLQELGRMRKVVLEAPDETTLKELAETLQQKNIDHMLWLEQPENIATCIALRPYPKEEVGQYLKKFRLFK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001013685
• RefSeq Size: 602
• RefSeq ORF: 420
• Synonyms: C2orf79
• Locus ID: 391356
• UniProt ID: Q6GMV3
• Cytogenetics: 2p23.3
• Summary: This gene encodes the enzyme peptidyl-tRNA hydrolase. Peptidyl-tRNA hydrolases perform the essential function of recycling peptidyl-tRNAs. Mutations in this gene are associated with autosomal-recessive intellectual disability and parkinsonism. [provided by RefSeq, May 2017]