REEP3 (NM_001001330) Human Mass Spec Standard

CAT#: PH309852

REEP3 MS Standard C13 and N15-labeled recombinant protein (NP_001001330)

Product Images

Coomassie blue staining of purified REEP3 protein (Cat# TP309852). The protein was produced from HEK293T cells transfected with REEP3 cDNA clone (Cat# RC209852) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209852
• Predicted MW: 29.3 kDa
• Protein Sequence:
  Sequence Link

  >RC209852 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVSWMISRAVVLVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTVAWFPLYYELKI
  AFVIWLLSPYTKGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVNFGRQGLNLAATAAVTAAVKS
  QGAITERLRSFSMHDLTTIQGDEPVGQRPYQPLPEAKKKSKPAPSESAGYGIPLKDGDEKTDEEAEGPYS
  DNEMLTHKGLRRSQSMKSVKTTKGRKEVRYGSLKYKVKKRPQVYF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001001330
• RefSeq Size: 5205
• RefSeq ORF: 765
• Synonyms: C10orf74; Yip2b
• Locus ID: 221035
• UniProt ID: Q6NUK4, X5DR89
• Cytogenetics: 10q21.3
• Summary: Microtubule-binding protein required to ensure proper cell division and nuclear envelope reassembly by sequestering the endoplasmic reticulum away from chromosomes during mitosis. Probably acts by clearing the endoplasmic reticulum membrane from metaphase chromosomes.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane