OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TPK1 (NM_022445) Human Mass Spec Standard

Be the first to review this product
SKU
PH309721
TPK1 MS Standard C13 and N15-labeled recombinant protein (NP_071890)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA333706 Rabbit Polyclonal Anti-TPK1 Antibody
100 ul
$585.00
LY411708 Transient overexpression lysate of thiamin pyrophosphokinase 1 (TPK1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "TPK1 or NM_022445"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209721
Predicted MW 27.2 kDa
Protein Sequence
Protein Sequence
>RC209721 protein sequence
Red=Cloning site Green=Tags(s)

MEHAFTPLEPLLSTGNLKYCLVILNQPLDNYFRHLWNKALLRACADGGANRLYDITEGERESFLPEFING
DFDSIRPEVREYYATKGCELISTPDQDHTDFTKCLKMLQKKIEEKDLKVDVIVTLGGLAGRFDQIMASVN
TLFQATHITPFPIIIIQEESLIYLLQPGKHRLHVDTGMEGDWCGLIPVGQPCSQVTTTGLKWNLTNDVLA
FGTLVSTSNTYDGSGVVTVETDHPLLWTMAIKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071890
RefSeq Size 2449
RefSeq ORF 729
Synonyms HTPK1; PP20; THMD5
Locus ID 27010
UniProt ID Q9H3S4
Cytogenetics 7q35
Summary The protein encoded by this gene functions as a homodimer and catalyzes the conversion of thiamine to thiamine pyrophosphate, a cofactor for some enzymes of the glycolytic and energy production pathways. Defects in this gene are a cause of thiamine metabolism dysfunction syndrome-5. provided by RefSeq, Apr 2017
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Thiamine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TPK1" proteins (5)
SKU Description Size Price
LC411708 Lyophilized TPK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420935 Lyophilized TPK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411708 Transient overexpression lysate of thiamin pyrophosphokinase 1 (TPK1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420935 Transient overexpression lysate of thiamin pyrophosphokinase 1 (TPK1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP309721 Recombinant protein of human thiamin pyrophosphokinase 1 (TPK1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products