TPK1 (NM_022445) Human Mass Spec Standard
CAT#: PH309721
TPK1 MS Standard C13 and N15-labeled recombinant protein (NP_071890)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209721 |
Predicted MW | 27.2 kDa |
Protein Sequence |
>RC209721 protein sequence
Red=Cloning site Green=Tags(s) MEHAFTPLEPLLSTGNLKYCLVILNQPLDNYFRHLWNKALLRACADGGANRLYDITEGERESFLPEFING DFDSIRPEVREYYATKGCELISTPDQDHTDFTKCLKMLQKKIEEKDLKVDVIVTLGGLAGRFDQIMASVN TLFQATHITPFPIIIIQEESLIYLLQPGKHRLHVDTGMEGDWCGLIPVGQPCSQVTTTGLKWNLTNDVLA FGTLVSTSNTYDGSGVVTVETDHPLLWTMAIKS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_071890 |
RefSeq Size | 2449 |
RefSeq ORF | 729 |
Synonyms | HTPK1; PP20; THMD5 |
Locus ID | 27010 |
UniProt ID | Q9H3S4, A0A090N8Y0 |
Cytogenetics | 7q35 |
Summary | The protein encoded by this gene functions as a homodimer and catalyzes the conversion of thiamine to thiamine pyrophosphate, a cofactor for some enzymes of the glycolytic and energy production pathways. Defects in this gene are a cause of thiamine metabolism dysfunction syndrome-5. [provided by RefSeq, Apr 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Thiamine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411708 | TPK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420935 | TPK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411708 | Transient overexpression lysate of thiamin pyrophosphokinase 1 (TPK1), transcript variant 1 |
USD 436.00 |
|
LY420935 | Transient overexpression lysate of thiamin pyrophosphokinase 1 (TPK1), transcript variant 2 |
USD 436.00 |
|
TP309721 | Recombinant protein of human thiamin pyrophosphokinase 1 (TPK1), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review