C5orf45 (MRNIP) (NM_016175) Human Mass Spec Standard

CAT#: PH309653

C5orf45 MS Standard C13 and N15-labeled recombinant protein (NP_057259)

Product Images

Coomassie blue staining of purified MRNIP protein (Cat# TP309653). The protein was produced from HEK293T cells transfected with MRNIP cDNA clone (Cat# RC209653) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209653
• Predicted MW: 37.6 kDa
• Protein Sequence:
  Sequence Link

  >RC209653 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASLQRSRVLRCCSCRLFQAHQVKKSVKWTCKACGEKQSFLQAYGEGSGADCRRHVQKLNLLQGQVSELP
  LRSLEETVSASEEENVGHQQAGNVKQQEKSQPSESRWLKYLEKDSQELELEGTGVCFSKQPSSKMEEPGP
  RFSQDLPRKRKWSGSTVQPPCSRGVQDSGGSEVAWGPQKGQAGLTWKVKQGSSPCLQENSADCSAGELRG
  PGKELWSPIQQVTATSSKWAQFVLPPRKSSHVDSEQPRSLQRDPRPAGPAQAKQGTPRAQASREGLSRPT
  AAVQLPRATHPVTSGSERPCGKTSWDARTPWAEGGPLVLEAQNPRPTRLCDLFITGEDFDDDV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057259
• RefSeq Size: 1229
• RefSeq ORF: 1029
• Synonyms: C5orf45
• Locus ID: 51149
• UniProt ID: Q6NTE8
• Cytogenetics: 5q35.3
• Summary: Plays a role in the cellular response to DNA damage and the maintenance of genome stability through its association with the MRN damage-sensing complex (PubMed:27568553). Promotes chromatin loading and activity of the MRN complex to facilitate subsequent ATM-mediated DNA damage response signaling and DNA repair (PubMed:27568553).[UniProtKB/Swiss-Prot Function]