C5orf45 (MRNIP) (NM_016175) Human Mass Spec Standard
CAT#: PH309653
C5orf45 MS Standard C13 and N15-labeled recombinant protein (NP_057259)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209653 |
Predicted MW | 37.6 kDa |
Protein Sequence |
>RC209653 protein sequence
Red=Cloning site Green=Tags(s) MASLQRSRVLRCCSCRLFQAHQVKKSVKWTCKACGEKQSFLQAYGEGSGADCRRHVQKLNLLQGQVSELP LRSLEETVSASEEENVGHQQAGNVKQQEKSQPSESRWLKYLEKDSQELELEGTGVCFSKQPSSKMEEPGP RFSQDLPRKRKWSGSTVQPPCSRGVQDSGGSEVAWGPQKGQAGLTWKVKQGSSPCLQENSADCSAGELRG PGKELWSPIQQVTATSSKWAQFVLPPRKSSHVDSEQPRSLQRDPRPAGPAQAKQGTPRAQASREGLSRPT AAVQLPRATHPVTSGSERPCGKTSWDARTPWAEGGPLVLEAQNPRPTRLCDLFITGEDFDDDV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057259 |
RefSeq Size | 1229 |
RefSeq ORF | 1029 |
Synonyms | C5orf45 |
Locus ID | 51149 |
UniProt ID | Q6NTE8 |
Cytogenetics | 5q35.3 |
Summary | Plays a role in the cellular response to DNA damage and the maintenance of genome stability through its association with the MRN damage-sensing complex (PubMed:27568553). Promotes chromatin loading and activity of the MRN complex to facilitate subsequent ATM-mediated DNA damage response signaling and DNA repair (PubMed:27568553).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414145 | C5orf45 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422227 | C5orf45 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414145 | Transient overexpression lysate of chromosome 5 open reading frame 45 (C5orf45), transcript variant 1 |
USD 436.00 |
|
LY422227 | Transient overexpression lysate of chromosome 5 open reading frame 45 (C5orf45), transcript variant 2 |
USD 436.00 |
|
TP309653 | Recombinant protein of human chromosome 5 open reading frame 45 (C5orf45), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review