MEAK7 (TLDC1) (NM_020947) Human Mass Spec Standard

CAT#: PH309287

KIAA1609 MS Standard C13 and N15-labeled recombinant protein (NP_065998)

Product Images

Coomassie blue staining of purified MEAK7 protein (Cat# TP309287). The protein was produced from HEK293T cells transfected with MEAK7 cDNA clone (Cat# RC209287) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209287
• Predicted MW: 51 kDa
• Protein Sequence:
  Sequence Link

  >RC209287 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNSRSRVGRSFCSQFLPEEQAEIDQLFDALSSDKNSPNVSSKSFSLKALQNHVGEALPPEMVTRLYDGM
  RRVDLTGKAKGPSENVSQEQFTASMSHLLKGNSEEKSLMIMKMISATEGPVKAREVQKFTEDLVGSVVHV
  LSHRQELRGWTGKEAPGPNPRVQVLAAQLLSDMKLQDGKRLLGPQWLDYDCDRAVIEDWVFRVPHVAIFL
  SVVICKGFLVLCSSLDLTTLVPERQVDQGRGFESILDVLSVMYINAQLPREQRHRWRLLFSSELHGHSFS
  QLCGHITHRGPCVAVLEDHDKHVFGGFASCSWEVKPQFQGDNRCFLFSICPSMAVYTHTGYNDHYMYLNH
  GQQTIPNGLGMGGQHNYFGLWVDVDFGKGHSRAKPTCTTYNSPQLSAQENFQFDKMEVWAVGDPSEEQLA
  KGNKSILDADPEAQALLEISGHSRHSEGLREVPDDE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065998
• RefSeq Size: 5031
• RefSeq ORF: 1368
• Synonyms: KIAA1609; mEAK-7; TLDC1
• Locus ID: 57707
• UniProt ID: Q6P9B6, A8K5C2
• Cytogenetics: 16q24.1
• Summary: Activates an alternative mTOR signaling through RPS6KB2 activation and EIF4EBP1 repression to regulate cell proliferation and migration (PubMed:29750193). Recruits MTOR at the lysosome, essential for MTOR signaling at the lysosome (PubMed:29750193).[UniProtKB/Swiss-Prot Function]