DRIL1 (ARID3A) (NM_005224) Human Mass Spec Standard

CAT#: PH309254

ARID3A MS Standard C13 and N15-labeled recombinant protein (NP_005215)

Product Images

Coomassie blue staining of purified ARID3A protein (Cat# TP309254). The protein was produced from HEK293T cells transfected with ARID3A cDNA clone (Cat# RC209254) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209254
• Predicted MW: 63 kDa
• Protein Sequence:
  Sequence Link

  >RC209254 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLQAVMETLLQRQQRARQELEARQQLPPDPPAAPHGRARAAPDEDREPESARMQRAQMAALAAMRAAAA
  GLGHPASPGGSEDGPPGSEEEDAAREGTPGSPGRGREGPGEEHFEDMASDEDMKPKWEEEEMEEDLGEDE
  EEEEEDYEDEEEEEDEEGLGPPGPASLGTTALFPRKAQPPQAFRGDGVPRVLGGQERPGPGPAHPGGAAH
  VAPQLQPPDHGDWTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVT
  EKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMEYLYPYECEKRGLSNPNELQAAIDSNRREGR
  RQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGH
  PVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQNFLAMAAQLP
  MSIRINSQASESRQDSAVNLTGTNGSNSISMSVEINGIMYTGVLFAQPPAPTPTSAPNKGGGGGGSSSSN
  AGGRGGNTGTSGGQAGPAGLSTPSTSTSNNSLP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005215
• RefSeq Size: 2823
• RefSeq ORF: 1779
• Synonyms: BRIGHT; DRIL1; DRIL3; E2FBP1
• Locus ID: 1820
• UniProt ID: Q99856
• Cytogenetics: 19p13.3
• Summary: This gene encodes a member of the ARID (AT-rich interaction domain) family of DNA binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation, and possibly in chromatin structure modification. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors