OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HBXIP (LAMTOR5) (NM_006402) Human Mass Spec Standard

Be the first to review this product
SKU
PH309098
HBXIP MS Standard C13 and N15-labeled recombinant protein (NP_006393)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY401923 Transient overexpression lysate of hepatitis B virus x interacting protein (HBXIP) (as WB positive control) 100 ug
$436.00

Other products for "HBXIP or NM_006402"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209098
Predicted MW 18.2 kDa
Protein Sequence
Protein Sequence
>RC209098 protein sequence
Red=Cloning site Green=Tags(s)

MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAV
PLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSD
PTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006393
RefSeq Size 855
RefSeq ORF 519
Synonyms HBXIP; XIP
Locus ID 10542
UniProt ID O43504
Cytogenetics 1p13.3
Summary This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HBXIP" proteins (3)
SKU Description Size Price
LC401923 Lyophilized LAMTOR5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401923 Transient overexpression lysate of hepatitis B virus x interacting protein (HBXIP) (as WB positive control) 100 ug
$436.00
TP309098 Recombinant protein of human hepatitis B virus x interacting protein (HBXIP), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products