NUP43 (NM_198887) Human Mass Spec Standard

CAT#: PH309014

NUP43 MS Standard C13 and N15-labeled recombinant protein (NP_942590)

Product Images

Coomassie blue staining of purified NUP43 protein (Cat# TP309014). The protein was produced from HEK293T cells transfected with NUP43 cDNA clone (Cat# RC209014) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209014
• Predicted MW: 42.2 kDa
• Protein Sequence:
  Sequence Link

  >RC209014 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEEIYAKFVSQKISKTRWRPLPPGSLQTAETFATGSWDNEENYISLWSIGDFGNLDSDGGFEGDHQLLCD
  IRHHGDVMDLQFFDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWTTAHYHTGPGSPSYSSAPCTGVVCN
  NPEIVTVGEDGRINLFRADHKEAVRTIDNADSSTLHAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQI
  LSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDVRQGTMPVSLLKAHEAEMWEVHFHPSNPEHLFTC
  SEDGSLWHWDASTDVPEKSSLFHQGGRSSTFLSHSISNQANVHQSVISSWLSTDPAKDRIEITSLLPSRS
  LSVNTLDVLGPCLVCGTDAEAIYVTRHLFS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_942590
• RefSeq Size: 3894
• RefSeq ORF: 1140
• Synonyms: bA350J20.1; p42
• Locus ID: 348995
• UniProt ID: Q8NFH3, Q8TEA6
• Cytogenetics: 6q25.1
• Summary: Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes (NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP43 is part of one such subcomplex, Nup107-160 (Loiodice et al., 2004 [PubMed 15146057]).[supplied by OMIM, Mar 2008]