NPM3 (NM_006993) Human Mass Spec Standard

CAT#: PH308869

NPM3 MS Standard C13 and N15-labeled recombinant protein (NP_008924)

Product Images

Coomassie blue staining of purified NPM3 protein (Cat# TP308869). The protein was produced from HEK293T cells transfected with NPM3 cDNA clone (Cat# RC208869) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208869
• Predicted MW: 19.3 kDa
• Protein Sequence:
  Sequence Link

  >RC208869 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLC
  LTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIV
  TMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_008924
• RefSeq Size: 904
• RefSeq ORF: 534
• Synonyms: PORMIN; TMEM123
• Locus ID: 10360
• UniProt ID: O75607
• Cytogenetics: 10q24.32
• Summary: The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleoplasmin and nucleophosmin, this protein likely functions as a molecular chaperone in the cell nucleus. [provided by RefSeq, Oct 2008]