OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NPM3 (NM_006993) Human Mass Spec Standard

Be the first to review this product
SKU
PH308869
NPM3 MS Standard C13 and N15-labeled recombinant protein (NP_008924)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY416276 Transient overexpression lysate of nucleophosmin/nucleoplasmin 3 (NPM3) (as WB positive control) 100 ug
$436.00

Other products for "NPM3 or NM_006993"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208869
Predicted MW 19.3 kDa
Protein Sequence
Protein Sequence
>RC208869 protein sequence
Red=Cloning site Green=Tags(s)

MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLC
LTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIV
TMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008924
RefSeq Size 904
RefSeq ORF 534
Synonyms PORMIN; TMEM123
Locus ID 10360
UniProt ID O75607
Cytogenetics 10q24.32
Summary The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleoplasmin and nucleophosmin, this protein likely functions as a molecular chaperone in the cell nucleus. provided by RefSeq, Oct 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NPM3" proteins (3)
SKU Description Size Price
LC416276 Lyophilized NPM3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416276 Transient overexpression lysate of nucleophosmin/nucleoplasmin 3 (NPM3) (as WB positive control) 100 ug
$436.00
TP308869 Recombinant protein of human nucleophosmin/nucleoplasmin, 3 (NPM3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products