HOXC8 (NM_022658) Human Mass Spec Standard
CAT#: PH308810
HOXC8 MS Standard C13 and N15-labeled recombinant protein (NP_073149)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208810 |
Predicted MW | 27.8 kDa |
Protein Sequence |
>RC208810 protein sequence
Red=Cloning site Green=Tags(s) MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNS GYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFP WMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNK DKLPGARDEEKVEEEGNEEEEKEEEEKEENKD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_073149 |
RefSeq Size | 2290 |
RefSeq ORF | 726 |
Synonyms | HOX3; HOX3A |
Locus ID | 3224 |
UniProt ID | P31273 |
Cytogenetics | 12q13.13 |
Summary | This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411602 | HOXC8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411602 | Transient overexpression lysate of homeobox C8 (HOXC8) |
USD 436.00 |
|
TP308810 | Recombinant protein of human homeobox C8 (HOXC8), 20 µg |
USD 867.00 |
|
TP761503 | Purified recombinant protein of Human homeobox C8 (HOXC8), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review