Carboxypeptidase H (CPE) (NM_001873) Human Mass Spec Standard
CAT#: PH308791
CPE MS Standard C13 and N15-labeled recombinant protein (NP_001864)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208791 |
Predicted MW | 53.15 kDa |
Protein Sequence |
>RC208791 representing NM_001873
Red=Cloning site Green=Tags(s) MAGRGGSALLALCGALAACGWLLGAEAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELREALVSVWLQC TAISRIYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNE TIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNH LLKNMKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQS LARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPP EETLKTYWEDNKNSLISYLEQIHRGVKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDYWRLLIPGNYK LTASAPGYLAITKKVAVPYSPAAGVDFELESFSERKEEEKEELMEWWKMMSETLNF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001864 |
RefSeq Size | 2443 |
RefSeq ORF | 1428 |
Synonyms | CPH; IDDHH |
Locus ID | 1363 |
UniProt ID | P16870, A0A384N679 |
Cytogenetics | 4q32.3 |
Summary | This gene encodes a member of the M14 family of metallocarboxypeptidases. The encoded preproprotein is proteolytically processed to generate the mature peptidase. This peripheral membrane protein cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. This protein may also function independently of its peptidase activity, as a neurotrophic factor that promotes neuronal survival, and as a sorting receptor that binds to regulated secretory pathway proteins, including prohormones. Mutations in this gene are implicated in type 2 diabetes. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Protein Pathways | Type I diabetes mellitus |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419701 | CPE HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419701 | Transient overexpression lysate of carboxypeptidase E (CPE) |
USD 436.00 |
|
TP308791 | Recombinant protein of human carboxypeptidase E (CPE), 20 µg |
USD 867.00 |
|
TP721092 | Purified recombinant protein of Human carboxypeptidase E (CPE) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review