NUDT10 (NM_153183) Human Mass Spec Standard

CAT#: PH308717

NUDT10 MS Standard C13 and N15-labeled recombinant protein (NP_694853)

Product Images

Coomassie blue staining of purified NUDT10 protein (Cat# TP308717). The protein was produced from HEK293T cells transfected with NUDT10 cDNA clone (Cat# RC208717) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208717
• Predicted MW: 18.5 kDa
• Protein Sequence:
  Sequence Link

  >RC208717 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEA
  GVKGKLGRLLGVFEQNQDPEHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYL
  EKLKLGGSPTNGNSMAPSSPDSDP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_694853
• RefSeq Size: 2018
• RefSeq ORF: 492
• Synonyms: APS2; DIPP3-alpha; DIPP3a
• Locus ID: 170685
• UniProt ID: Q8NFP7
• Cytogenetics: Xp11.22
• Summary: This gene is a member of the nudix (nucleoside diphosphate linked moiety X)-type motif containing family. The encoded protein is a phosphohydrolase and may regulate the turnover of diphosphoinositol polyphosphates. The turnover of these high-energy diphosphoinositol polyphosphates represents a molecular switching activity with important regulatory consequences. Molecular switching by diphosphoinositol polyphosphates may contribute to the regulation of intracellular trafficking. In some populations putative prostate cancer susceptibility alleles have been identified for this gene. Alternatively spliced transcript variants, which differ only in the 5' UTR, have been found for this gene. [provided by RefSeq, Feb 2015]