LRATD1 (NM_145175) Human Mass Spec Standard

CAT#: PH308623

FAM84A MS Standard C13 and N15-labeled recombinant protein (NP_660158)

Product Images

Coomassie blue staining of purified LRATD1 protein (Cat# TP308623). The protein was produced from HEK293T cells transfected with LRATD1 cDNA clone (Cat# RC208623) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208623
• Predicted MW: 32.5 kDa
• Protein Sequence:
  Sequence Link

  >RC208623 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSR
  HHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQPAPEPPAP
  APHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWT
  NSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRV
  LQELADLVDDKE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_660158
• RefSeq Size: 6366
• RefSeq ORF: 876
• Synonyms: FAM84A; NSE1; PP11517
• Locus ID: 151354
• UniProt ID: Q96KN4
• Cytogenetics: 2p24.3
• Summary: May play a role in cell morphology and motility.[UniProtKB/Swiss-Prot Function]