Renin (REN) (NM_000537) Human Mass Spec Standard
CAT#: PH308382
REN MS Standard C13 and N15-labeled recombinant protein (NP_000528)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208382 |
Predicted MW | 45.1 kDa |
Protein Sequence |
>RC208382 protein sequence
Red=Cloning site Green=Tags(s) MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLG NTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKH NGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIF DNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSST LLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADY VFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000528 |
RefSeq Size | 1493 |
RefSeq ORF | 1218 |
Synonyms | ADTKD4; HNFJ2; RTD |
Locus ID | 5972 |
UniProt ID | P00797 |
Cytogenetics | 1q32.1 |
Summary | This gene encodes renin, an aspartic protease that is secreted by the kidneys. Renin is a part of the renin-angiotensin-aldosterone system involved in regulation of blood pressure, and electrolyte balance. This enzyme catalyzes the first step in the activation pathway of angiotensinogen by cleaving angiotensinogen to form angiotensin I, which is then converted to angiotensin II by angiotensin I converting enzyme. This cascade can result in aldosterone release, narrowing of blood vessels, and increase in blood pressure as angiotension II is a vasoconstrictive peptide. Transcript variants that encode different protein isoforms and that arise from alternative splicing and the use of alternative promoters have been described, but their full-length nature has not been determined. Mutations in this gene have been shown to cause hyperuricemic nephropathy familial juvenile 2, familial hyperproreninemia, and renal tubular dysgenesis. [provided by RefSeq, May 2020] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Renin-angiotensin system |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424660 | REN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY424660 | Transient overexpression lysate of renin (REN) |
USD 436.00 |
|
TP308382 | Recombinant protein of human renin (REN), 20 µg |
USD 867.00 |
|
TP750151 | Purified recombinant protein of Human renin (REN), 131Asp-End, with N-terminal HIS tag, expressed in E.Coli, 50 ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review