TFIISH (TCEA3) (NM_003196) Human Mass Spec Standard

CAT#: PH308347

TCEA3 MS Standard C13 and N15-labeled recombinant protein (NP_003187)

Product Images

Coomassie blue staining of purified TCEA3 protein (Cat# TP308347). The protein was produced from HEK293T cells transfected with TCEA3 cDNA clone (Cat# RC208347) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208347
• Predicted MW: 39 kDa
• Protein Sequence:
  Sequence Link

  >RC208347 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGQEEELLRIAKKLEKMVARKNTEGALDLLKKLHSCQMSIQLLQTTRIGVAVNGVRKHCSDKEVVSLAKV
  LIKNWKRLLDSPGPPKGEKGEEREKAKKKEKGLECSDWKPEAGLSPPRKKREDPKTRRDSVDSKSSASSS
  PKRPSVERSNSSKSKAESPKTPSSPLTPTFASSMCLLAPCYLTGDSVRDKCVEMLSAALKADDDYKDYGV
  NCDKMASEIEDHIYQELKSTDMKYRNRVRSRISNLKDPRNPGLRRNVLSGAISAGLIAKMTAEEMASDEL
  RELRNAMTQEAIREHQMAKTGGTTTDLFQCSKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKFC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003187
• RefSeq Size: 1586
• RefSeq ORF: 1044
• Synonyms: TFIIS; TFIIS.H
• Locus ID: 6920
• UniProt ID: O75764, B4DUM4
• Cytogenetics: 1p36.12
• Summary: Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors