HSD11B2 (NM_000196) Human Mass Spec Standard
CAT#: PH307796
HSD11B2 MS Standard C13 and N15-labeled recombinant protein (NP_000187)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207796 |
Predicted MW | 44.1 kDa |
Protein Sequence |
>RC207796 protein sequence
Red=Cloning site Green=Tags(s) MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALS RLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLT KPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSS RGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRK QLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFI HYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQGPNLSPGPSPAVAR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000187 |
RefSeq Size | 1939 |
RefSeq ORF | 1215 |
Synonyms | AME; AME1; HSD2; HSD11K; SDR9C3 |
Locus ID | 3291 |
UniProt ID | P80365 |
Cytogenetics | 16q22.1 |
Summary | There are at least two isozymes of the corticosteroid 11-beta-dehydrogenase, a microsomal enzyme complex responsible for the interconversion of cortisol and cortisone. The type I isozyme has both 11-beta-dehydrogenase (cortisol to cortisone) and 11-oxoreductase (cortisone to cortisol) activities. The type II isozyme, encoded by this gene, has only 11-beta-dehydrogenase activity. In aldosterone-selective epithelial tissues such as the kidney, the type II isozyme catalyzes the glucocorticoid cortisol to the inactive metabolite cortisone, thus preventing illicit activation of the mineralocorticoid receptor. In tissues that do not express the mineralocorticoid receptor, such as the placenta and testis, it protects cells from the growth-inhibiting and/or pro-apoptotic effects of cortisol, particularly during embryonic development. Mutations in this gene cause the syndrome of apparent mineralocorticoid excess and hypertension. [provided by RefSeq, Feb 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Androgen and estrogen metabolism, C21-Steroid hormone metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424870 | HSD11B2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY424870 | Transient overexpression lysate of hydroxysteroid (11-beta) dehydrogenase 2 (HSD11B2) |
USD 436.00 |
|
TP307796 | Recombinant protein of human hydroxysteroid (11-beta) dehydrogenase 2 (HSD11B2), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review