Dermatopontin (DPT) (NM_001937) Human Mass Spec Standard
CAT#: PH307588
DPT MS Standard C13 and N15-labeled recombinant protein (NP_001928)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207588 |
Predicted MW | 24 kDa |
Protein Sequence |
>RC207588 protein sequence
Red=Cloning site Green=Tags(s) MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSD RQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCP YSCWLTIEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001928 |
RefSeq Size | 1749 |
RefSeq ORF | 603 |
Synonyms | TRAMP |
Locus ID | 1805 |
UniProt ID | Q07507 |
Cytogenetics | 1q24.2 |
Summary | Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419639 | DPT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419639 | Transient overexpression lysate of dermatopontin (DPT) |
USD 436.00 |
|
TP307588 | Recombinant protein of human dermatopontin (DPT), 20 µg |
USD 867.00 |
|
TP721061 | Purified recombinant protein of Human dermatopontin (DPT) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review