OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BST2 (NM_004335) Human Mass Spec Standard

Be the first to review this product
SKU
PH307540
BST2 MS Standard C13 and N15-labeled recombinant protein (NP_004326)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA337141 Rabbit Polyclonal BST2 Antibody
100 ug
$610.00
LY401380 Transient overexpression lysate of bone marrow stromal cell antigen 2 (BST2) (as WB positive control) 100 ug
$436.00

Other products for "BST2 or NM_004335"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207540
Predicted MW 19.8 kDa
Protein Sequence
Protein Sequence
>RC207540 protein sequence
Red=Cloning site Green=Tags(s)

MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLL
QQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRE
NQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004326
RefSeq Size 1048
RefSeq ORF 540
Synonyms CD317; HM1.24; TETHERIN
Locus ID 684
UniProt ID Q10589
Cytogenetics 19p13.11
Summary Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BST2" proteins (3)
SKU Description Size Price
LC401380 Lyophilized BST2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401380 Transient overexpression lysate of bone marrow stromal cell antigen 2 (BST2) (as WB positive control) 100 ug
$436.00
TP307540 Recombinant protein of human bone marrow stromal cell antigen 2 (BST2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products