BST2 (NM_004335) Human Mass Spec Standard
CAT#: PH307540
BST2 MS Standard C13 and N15-labeled recombinant protein (NP_004326)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207540 |
Predicted MW | 19.8 kDa |
Protein Sequence |
>RC207540 protein sequence
Red=Cloning site Green=Tags(s) MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLL QQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRE NQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004326 |
RefSeq Size | 1048 |
RefSeq ORF | 540 |
Synonyms | CD317; HM1.24; TETHERIN |
Locus ID | 684 |
UniProt ID | Q10589, A0A024R7H5 |
Cytogenetics | 19p13.11 |
Summary | Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401380 | BST2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401380 | Transient overexpression lysate of bone marrow stromal cell antigen 2 (BST2) |
USD 436.00 |
|
TP307540 | Recombinant protein of human bone marrow stromal cell antigen 2 (BST2), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review