RAP2A (NM_021033) Human Mass Spec Standard

CAT#: PH307180

RAP2A MS Standard C13 and N15-labeled recombinant protein (NP_066361)

Product Images

Coomassie blue staining of purified RAP2A protein (Cat# TP307180). The protein was produced from HEK293T cells transfected with RAP2A cDNA clone (Cat# RC207180) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207180
• Predicted MW: 20.6 kDa
• Protein Sequence:
  Sequence Link

  >RC207180 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL
  YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGC
  PFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_066361
• RefSeq Size: 4358
• RefSeq ORF: 549
• Synonyms: K-REV; KREV; RAP2; RbBP-30
• Locus ID: 5911
• UniProt ID: P10114
• Cytogenetics: 13q32.1
• Summary: Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. In its active form interacts with and regulates several effectors including MAP4K4, MINK1 and TNIK. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. More generally, it is part of several signaling cascades and may regulate cytoskeletal rearrangements, cell migration, cell adhesion and cell spreading.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome