OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAP2A (NM_021033) Human Mass Spec Standard

Be the first to review this product
SKU
PH307180
RAP2A MS Standard C13 and N15-labeled recombinant protein (NP_066361)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358606 RAP2A Antibody - N-terminal region
100 ul
$585.00
LY402824 Transient overexpression lysate of RAP2A, member of RAS oncogene family (RAP2A) (as WB positive control) 100 ug
$436.00

Other products for "RAP2A or NM_021033"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207180
Predicted MW 20.6 kDa
Protein Sequence
Protein Sequence
>RC207180 protein sequence
Red=Cloning site Green=Tags(s)

MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL
YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGC
PFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066361
RefSeq Size 4358
RefSeq ORF 549
Synonyms K-REV; KREV; RAP2; RbBP-30
Locus ID 5911
UniProt ID P10114
Cytogenetics 13q32.1
Summary Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. In its active form interacts with and regulates several effectors including MAP4K4, MINK1 and TNIK. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. More generally, it is part of several signaling cascades and may regulate cytoskeletal rearrangements, cell migration, cell adhesion and cell spreading.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAP2A" proteins (3)
SKU Description Size Price
LC402824 Lyophilized RAP2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402824 Transient overexpression lysate of RAP2A, member of RAS oncogene family (RAP2A) (as WB positive control) 100 ug
$436.00
TP307180 Recombinant protein of human RAP2A, member of RAS oncogene family (RAP2A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products