Neurogenin 1 (NEUROG1) (NM_006161) Human Mass Spec Standard

CAT#: PH307029

NEUROG1 MS Standard C13 and N15-labeled recombinant protein (NP_006152)

Product Images

Coomassie blue staining of purified NEUROG1 protein (Cat# TP307029). The protein was produced from HEK293T cells transfected with NEUROG1 cDNA clone (Cat# RC207029) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207029
• Predicted MW: 25.7 kDa
• Protein Sequence:
  Sequence Link

  >RC207029 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPARLETCISDLDCASSSGSDLSGFLTDEEDCARLQQAASASGPPAPARRGAPNISRASEVPGAQDDEQE
  RRRRRGRTRVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKIETLRFAYNY
  IWALAETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPASDAESWGSGAAAASPLSDPSSPAASEDFTY
  RPGDPVFSFPSLPKDLLHTTPCFIPYH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006152
• RefSeq Size: 1717
• RefSeq ORF: 711
• Synonyms: AKA; bHLHa6; Math4C; NEUROD3; ngn1
• Locus ID: 4762
• UniProt ID: Q92886, F1T0H3
• Cytogenetics: 5q31.1
• Summary: Acts as a transcriptional regulator. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Associates with chromatin to enhancer regulatory elements in genes encoding key transcriptional regulators of neurogenesis (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors