Neurogenin 1 (NEUROG1) (NM_006161) Human Mass Spec Standard
CAT#: PH307029
NEUROG1 MS Standard C13 and N15-labeled recombinant protein (NP_006152)
Frequently bought together (2)
Other products for "Neurogenin 1"
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207029 |
Predicted MW | 25.7 kDa |
Protein Sequence |
>RC207029 protein sequence
Red=Cloning site Green=Tags(s) MPARLETCISDLDCASSSGSDLSGFLTDEEDCARLQQAASASGPPAPARRGAPNISRASEVPGAQDDEQE RRRRRGRTRVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKIETLRFAYNY IWALAETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPASDAESWGSGAAAASPLSDPSSPAASEDFTY RPGDPVFSFPSLPKDLLHTTPCFIPYH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006152 |
RefSeq Size | 1717 |
RefSeq ORF | 711 |
Synonyms | AKA; bHLHa6; Math4C; NEUROD3; ngn1 |
Locus ID | 4762 |
UniProt ID | Q92886, F1T0H3 |
Cytogenetics | 5q31.1 |
Summary | Acts as a transcriptional regulator. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Associates with chromatin to enhancer regulatory elements in genes encoding key transcriptional regulators of neurogenesis (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.