MTLRP (GHRL) (NM_016362) Human Mass Spec Standard
CAT#: PH306989
GHRL MS Standard C13 and N15-labeled recombinant protein (NP_057446)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206989 |
Predicted MW | 12.9 kDa |
Protein Sequence |
>RC206989 protein sequence
Red=Cloning site Green=Tags(s) MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAED EMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057446 |
RefSeq Size | 552 |
RefSeq ORF | 351 |
Synonyms | MTLRP |
Locus ID | 51738 |
UniProt ID | Q9UBU3 |
Cytogenetics | 3p25.3 |
Summary | This gene encodes the ghrelin-obestatin preproprotein that is cleaved to yield two peptides, ghrelin and obestatin. Ghrelin is a powerful appetite stimulant and plays an important role in energy homeostasis. Its secretion is initiated when the stomach is empty, whereupon it binds to the growth hormone secretagogue receptor in the hypothalamus which results in the secretion of growth hormone (somatotropin). Ghrelin is thought to regulate multiple activities, including hunger, reward perception via the mesolimbic pathway, gastric acid secretion, gastrointestinal motility, and pancreatic glucose-stimulated insulin secretion. It was initially proposed that obestatin plays an opposing role to ghrelin by promoting satiety and thus decreasing food intake, but this action is still debated. Recent reports suggest multiple metabolic roles for obestatin, including regulating adipocyte function and glucose metabolism. Alternative splicing results in multiple transcript variants. In addition, antisense transcripts for this gene have been identified and may potentially regulate ghrelin-obestatin preproprotein expression. [provided by RefSeq, Nov 2014] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402547 | GHRL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402547 | Transient overexpression lysate of ghrelin/obestatin prepropeptide (GHRL), transcript variant 1 |
USD 436.00 |
|
TP306989 | Purified recombinant protein of Homo sapiens ghrelin/obestatin prepropeptide (GHRL), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review