MRFAP1 (NM_033296) Human Mass Spec Standard
CAT#: PH306815
MRFAP1 MS Standard C13 and N15-labeled recombinant protein (NP_150638)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206815 |
Predicted MW | 14.6 kDa |
Protein Sequence |
>RC206815 protein sequence
Red=Cloning site Green=Tags(s) MRPLDIVELAEPEEVEVLEPEEDFEQFLLPVINEMREDIASLTREHGRAYLRNRSKLWEMDNMLIQIKTQ VEASEESALNHLQNPGDAAEGRAAKRCEKAEEKAKEIAKMAEMLVELVRRIEKSESS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_150638 |
RefSeq Size | 2184 |
RefSeq ORF | 381 |
Synonyms | PAM14; PGR1 |
Locus ID | 93621 |
UniProt ID | Q9Y605, B3KQA0 |
Cytogenetics | 4p16.1 |
Summary | This gene encodes an intracellular protein that interacts with members of the MORF4/MRG (mortality factor on chromosome 4/MORF4 related gene) family and the tumor suppressor Rb (retinoblastoma protein.) The protein may play a role in senescence, cell growth and immortalization. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409615 | MRFAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY409615 | Transient overexpression lysate of Mof4 family associated protein 1 (MRFAP1) |
USD 436.00 |
|
TP306815 | Recombinant protein of human Mof4 family associated protein 1 (MRFAP1), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review