OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MRFAP1 (NM_033296) Human Mass Spec Standard

Be the first to review this product
SKU
PH306815
MRFAP1 MS Standard C13 and N15-labeled recombinant protein (NP_150638)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA337947 Rabbit Polyclonal Anti-MRFAP1 Antibody
100 ul
$585.00
LY409615 Transient overexpression lysate of Mof4 family associated protein 1 (MRFAP1) (as WB positive control) 100 ug
$436.00

Other products for "MRFAP1 or NM_033296"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206815
Predicted MW 14.6 kDa
Protein Sequence
Protein Sequence
>RC206815 protein sequence
Red=Cloning site Green=Tags(s)

MRPLDIVELAEPEEVEVLEPEEDFEQFLLPVINEMREDIASLTREHGRAYLRNRSKLWEMDNMLIQIKTQ
VEASEESALNHLQNPGDAAEGRAAKRCEKAEEKAKEIAKMAEMLVELVRRIEKSESS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_150638
RefSeq Size 2184
RefSeq ORF 381
Synonyms PAM14; PGR1
Locus ID 93621
UniProt ID Q9Y605
Cytogenetics 4p16.1
Summary This gene encodes an intracellular protein that interacts with members of the MORF4/MRG (mortality factor on chromosome 4/MORF4 related gene) family and the tumor suppressor Rb (retinoblastoma protein.) The protein may play a role in senescence, cell growth and immortalization. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jan 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MRFAP1" proteins (3)
SKU Description Size Price
LC409615 Lyophilized MRFAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409615 Transient overexpression lysate of Mof4 family associated protein 1 (MRFAP1) (as WB positive control) 100 ug
$436.00
TP306815 Recombinant protein of human Mof4 family associated protein 1 (MRFAP1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products