PHLDA3 (NM_012396) Human Mass Spec Standard
CAT#: PH306751
PHLDA3 MS Standard C13 and N15-labeled recombinant protein (NP_036528)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206751 |
Predicted MW | 13.9 kDa |
Protein Sequence |
>RC206751 protein sequence
Red=Cloning site Green=Tags(s) MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRH IYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_036528 |
RefSeq Size | 1516 |
RefSeq ORF | 381 |
Synonyms | TIH1 |
Locus ID | 23612 |
UniProt ID | Q9Y5J5 |
Cytogenetics | 1q32.1 |
Summary | p53/TP53-regulated repressor of Akt/AKT1 signaling. Represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity. Its direct transcription regulation by p53/TP53 may explain how p53/TP53 can negatively regulate AKT1. May act as a tumor suppressor.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415793 | PHLDA3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415793 | Transient overexpression lysate of pleckstrin homology-like domain, family A, member 3 (PHLDA3) |
USD 436.00 |
|
TP306751 | Recombinant protein of human pleckstrin homology-like domain, family A, member 3 (PHLDA3), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review