OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PHLDA3 (NM_012396) Human Mass Spec Standard

Be the first to review this product
SKU
PH306751
PHLDA3 MS Standard C13 and N15-labeled recombinant protein (NP_036528)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY415793 Transient overexpression lysate of pleckstrin homology-like domain, family A, member 3 (PHLDA3) (as WB positive control) 100 ug
$436.00

Other products for "PHLDA3 or NM_012396"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206751
Predicted MW 13.9 kDa
Protein Sequence
Protein Sequence
>RC206751 protein sequence
Red=Cloning site Green=Tags(s)

MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRH
IYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036528
RefSeq Size 1516
RefSeq ORF 381
Synonyms TIH1
Locus ID 23612
UniProt ID Q9Y5J5
Cytogenetics 1q32.1
Summary p53/TP53-regulated repressor of Akt/AKT1 signaling. Represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity. Its direct transcription regulation by p53/TP53 may explain how p53/TP53 can negatively regulate AKT1. May act as a tumor suppressor.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PHLDA3" proteins (3)
SKU Description Size Price
LC415793 Lyophilized PHLDA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415793 Transient overexpression lysate of pleckstrin homology-like domain, family A, member 3 (PHLDA3) (as WB positive control) 100 ug
$436.00
TP306751 Recombinant protein of human pleckstrin homology-like domain, family A, member 3 (PHLDA3), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products