PHLDA3 (NM_012396) Human Mass Spec Standard

CAT#: PH306751

PHLDA3 MS Standard C13 and N15-labeled recombinant protein (NP_036528)

Product Images

Coomassie blue staining of purified PHLDA3 protein (Cat# TP306751). The protein was produced from HEK293T cells transfected with PHLDA3 cDNA clone (Cat# RC206751) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206751
• Predicted MW: 13.9 kDa
• Protein Sequence:
  Sequence Link

  >RC206751 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRH
  IYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036528
• RefSeq Size: 1516
• RefSeq ORF: 381
• Synonyms: TIH1
• Locus ID: 23612
• UniProt ID: Q9Y5J5
• Cytogenetics: 1q32.1
• Summary: p53/TP53-regulated repressor of Akt/AKT1 signaling. Represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity. Its direct transcription regulation by p53/TP53 may explain how p53/TP53 can negatively regulate AKT1. May act as a tumor suppressor.[UniProtKB/Swiss-Prot Function]