MS4A15 (NM_152717) Human Mass Spec Standard

CAT#: PH306747

MS4A15 MS Standard C13 and N15-labeled recombinant protein (NP_689930)

Product Images

Coomassie blue staining of purified MS4A15 protein (Cat# TP306747). The protein was produced from HEK293T cells transfected with MS4A15 cDNA clone (Cat# RC206747) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206747
• Predicted MW: 15.4 kDa
• Protein Sequence:
  Sequence Link

  >RC206747 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVRRGHVGIFFIEGGVPFWGGACFIISGSLSVAAEKNHTSCLVRSSLGTNILSVMAAFAGTAILLMDFGV
  TNRDVDRGYLAVLTIFTVLEFFTAVIAMHFGCQAIHAQASAPVIFLPNAFSADFNIPSPAASAPPAYDNV
  AYAQGVV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689930
• RefSeq Size: 1693
• RefSeq ORF: 441
• Locus ID: 219995
• UniProt ID: Q8N5U1
• Cytogenetics: 11q12.2
• Summary: May be involved in signal transduction as a component of a multimeric receptor complex.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane