RABIF (NM_002871) Human Mass Spec Standard

CAT#: PH306632

RABIF MS Standard C13 and N15-labeled recombinant protein (NP_002862)

Product Images

Coomassie blue staining of purified RABIF protein (Cat# TP306632). The protein was produced from HEK293T cells transfected with RABIF cDNA clone (Cat# RC206632) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206632
• Predicted MW: 13.8 kDa
• Protein Sequence:
  Sequence Link

  >RC206632 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWL
  VEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002862
• RefSeq Size: 3227
• RefSeq ORF: 369
• Synonyms: MSS4; RASGFR3; RASGRF3
• Locus ID: 5877
• UniProt ID: P47224, Q53EV1
• Cytogenetics: 1q32.1
• Summary: This gene encodes a member of the SCE4/YPT1/RAB family of small GTP-binding proteins that are involved in the regulation of intracellular vesicular transport. This protein stimulates GTP-GDP exchange in SEC4, and to a lesser extent in YPT1 and RAB3A, and may play a general role in vesicular transport. [provided by RefSeq, Oct 2011]