TRIM (TRAT1) (NM_016388) Human Mass Spec Standard
CAT#: PH306479
TRAT1 MS Standard C13 and N15-labeled recombinant protein (NP_057472)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206479 |
Predicted MW | 21.2 kDa |
Protein Sequence |
>RC206479 protein sequence
Red=Cloning site Green=Tags(s) MSGISGCPFFLWGLLALLGLALVISLIFNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMI SEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQL HAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057472 |
RefSeq Size | 1695 |
RefSeq ORF | 558 |
Synonyms | HSPC062; pp29/30; TCRIM; TRIM |
Locus ID | 50852 |
UniProt ID | Q6PIZ9 |
Cytogenetics | 3q13.13 |
Summary | Stabilizes the TCR (T-cell antigen receptor)/CD3 complex at the surface of T-cells.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413992 | TRAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413992 | Transient overexpression lysate of T cell receptor associated transmembrane adaptor 1 (TRAT1) |
USD 436.00 |
|
TP306479 | Recombinant protein of human T cell receptor associated transmembrane adaptor 1 (TRAT1), 20 µg |
USD 867.00 |
|
TP720879 | Purified recombinant protein of Human T cell receptor associated transmembrane adaptor 1 (TRAT1) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review