C11orf75 (SMCO4) (NM_020179) Human Mass Spec Standard
CAT#: PH306466
C11orf75 MS Standard C13 and N15-labeled recombinant protein (NP_064564)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206466 |
Predicted MW | 6.7 kDa |
Protein Sequence |
>RC206466 protein sequence
Red=Cloning site Green=Tags(s) MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPTITE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_064564 |
RefSeq Size | 979 |
RefSeq ORF | 177 |
Synonyms | C11orf75; FN5 |
Locus ID | 56935 |
UniProt ID | Q9NRQ5, A0A024R3A3 |
Cytogenetics | 11q21 |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412602 | SMCO4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY412602 | Transient overexpression lysate of chromosome 11 open reading frame 75 (C11orf75) |
USD 436.00 |
|
TP306466 | Recombinant protein of human chromosome 11 open reading frame 75 (C11orf75), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review