SAP30BP (NM_013260) Human Mass Spec Standard

CAT#: PH306462

SAP30BP MS Standard C13 and N15-labeled recombinant protein (NP_037392)

Product Images

Coomassie blue staining of purified SAP30BP protein (Cat# TP306462). The protein was produced from HEK293T cells transfected with SAP30BP cDNA clone (Cat# RC206462) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206462
• Predicted MW: 33.9 kDa
• Protein Sequence:
  Sequence Link

  >RC206462 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSR
  QSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYE
  RKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDK
  LEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPA
  VVTVTTSASGSKTTVISAVGTIVKKAKQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_037392
• RefSeq Size: 2758
• RefSeq ORF: 924
• Synonyms: HCNGP; HTRG; HTRP
• Locus ID: 29115
• UniProt ID: Q9UHR5, A0A024R8R0
• Cytogenetics: 17q25.1
• Summary: Induces cell death. May act as a transcriptional corepressor of a gene related to cell survival. May be involved in the regulation of beta-2-microglobulin genes.[UniProtKB/Swiss-Prot Function]