RPL18 (NM_000979) Human Mass Spec Standard

CAT#: PH306317

RPL18 MS Standard C13 and N15-labeled recombinant protein (NP_000970)

Product Images

Coomassie blue staining of purified RPL18 protein (Cat# TP306317). The protein was produced from HEK293T cells transfected with RPL18 cDNA clone (Cat# RC206317) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206317
• Predicted MW: 21.7 kDa
• Protein Sequence:
  Sequence Link

  >RC206317 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLCLSRMIRKM
  KLPGRENKTAVVVGTITDDVRVQEVPKLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLS
  GPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000970
• RefSeq Size: 893
• RefSeq ORF: 564
• Synonyms: DBA18; L18
• Locus ID: 6141
• UniProt ID: Q07020, A0A024QZD1
• Cytogenetics: 19q13.33
• Summary: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L18E family of ribosomal proteins that is a component of the 60S subunit. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
• Protein Pathways: Ribosome